HPA018297

Sigma-Aldrich

Anti-USP25 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):
Anti-USP on chromosome 21, Anti-Ubiquitin thioesterase 25, Anti-Ubiquitin carboxyl-terminal hydrolase 25, Anti-Deubiquitinating enzyme 25, Anti-Ubiquitin-specific-processing protease 25
Human Protein Atlas Number:

biological source

rabbit

Quality Level

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

packaging

antibody small pack of 25 μL

enhanced validation

RNAi knockdown
Learn more about Antibody Enhanced Validation

application(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

QPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK

conjugate

unconjugated

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... USP25(29761)

General description

The gene USP25 (ubiquitin-specific-processing protease 25) has been mapped to human chromosome 21q11.2. It contains three ubiquitin binding domains at the amino-terminus: one ubiquitin-associated domain and two ubiquitin-interacting motifs. USP25 encodes three different protein isoforms produced by alternate splicing: two are expressed ubiquitously and the longest is restricted to muscle tissues. USP25 is mainly present in the cytoplasm.

Immunogen

Ubiquitin carboxyl-terminal hydrolase 25 recombinant protein epitope signature tag (PrEST)

Biochem/physiol Actions

Ubiquitin-specific-processing protease 25 (USP25) is a specific-ubiquitin protease gene. SUMOylation of USP25 impairs its activity by reducing the affinity to ubiquitin chains. In muscle tissues, USP25 is up-regulated during myogenesis. USP25 interacts with myosisn binding protein C1 and protects the latter from degradation which is important in muscle differentiation and maintenance. USP25 is a negative regulator of the virus-triggered type I interferon (IFN) signalling pathway. RT-PCR analysis showed up-regulation of USP25 in Down′s syndrome fetal brains in mouse model. USP25 is down-regulated in human lung cancer. MiR-200c exerts tumor-suppressive effects of non-small-cell lung cancer though suppression of USP25 expression.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73924.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Personal Protective Equipment

dust mask type N95 (US),Eyeshields,Gloves

RIDADR

NONH for all modes of transport

WGK Germany

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Certificate of Analysis
Certificate of Origin
Huijuan Zhong et al.
PloS one, 8(11), e80976-e80976 (2013-11-22)
Ubiquitination and deubiquitination have emerged as critical regulatory processes in the virus-triggered type I interferon (IFN) induction pathway. In this study, we carried out a targeted siRNA screen of 54 ubiquitin-specific proteases (USPs) and identified USP25 as a negative regulator...
Amanda Denuc et al.
PloS one, 4(5), e5571-e5571 (2009-05-15)
USP25m is the muscle isoform of the deubiquitinating (DUB) enzyme USP25. Similarly to most DUBs, data on USP25 regulation and substrate recognition is scarce. In silico analysis predicted three ubiquitin binding domains (UBDs) at the N-terminus: one ubiquitin-associated domain (UBA)...
R Valero et al.
Genomics, 62(3), 395-405 (2000-01-25)
We have identified a new gene, USP25, spanning over 150 kb at 21q11. 2, one of the lowest gene-density regions of the human genome. USP25 is made up of 25 exons and encodes a 1087-aa protein. Database comparisons reveal high...
Erik Meulmeester et al.
Molecular cell, 30(5), 610-619 (2008-06-10)
Vertebrates express two distinct families of SUMO proteins (SUMO1 and SUMO2/3) that serve distinct functions as posttranslational modifiers. Many proteins are modified specifically with SUMO1 or SUMO2/3, but the mechanisms for paralog selectivity are poorly understood. In a screen for...
Hideki Yamada et al.
Genes, chromosomes & cancer, 47(9), 810-818 (2008-06-05)
The frequent presence of loss of heterozygosity (LOH) at 21q21 in lung cancer suggests the existence of putative tumor suppressor genes in this genomic region. Furthermore, the identification of a homozygous deletion in this region has lent further support for...

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service

Social Media

LinkedIn icon
Twitter icon
Facebook Icon

MilliporeSigma

Research. Development. Production.

We are a leading supplier to the global Life Science industry with solutions and services for research, biotechnology development and production, and pharmaceutical drug therapy development and production.

© 2021 Merck KGaA, Darmstadt, Germany and/or its affiliates. All Rights Reserved.

Reproduction of any materials from the site is strictly forbidden without permission.